PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021257-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 383aa    MW: 42774.8 Da    PI: 5.3926
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021257-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.68e-1573120148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEd++l+++    G g+W+ +ar  g+ R++k+c++rw +yl
    NNU_021257-RA  73 KGLWSPEEDDKLINYMLSNGQGCWSDVARNAGLQRCGKSCRLRWINYL 120
                      678*******************************************97 PP

2Myb_DNA-binding52.11.6e-16126169146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
    NNU_021257-RA 126 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 169
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.46468120IPR017930Myb domain
SuperFamilySSF466899.77E-2871167IPR009057Homeodomain-like
SMARTSM007174.5E-1172122IPR001005SANT/Myb domain
PfamPF002491.7E-1373120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2274127IPR009057Homeodomain-like
CDDcd001673.40E-976120No hitNo description
PROSITE profilePS5129425.918121175IPR017930Myb domain
SMARTSM007174.9E-16125173IPR001005SANT/Myb domain
PfamPF002492.5E-15126169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-26128176IPR009057Homeodomain-like
CDDcd001672.83E-11128168No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MHLCLCASLY QSTFLCLSLS FFYLSPSYKI FSPLLQIQLR EQGLQGTLYC KQEMRKPDPL  60
GKKNNNIPNK LRKGLWSPEE DDKLINYMLS NGQGCWSDVA RNAGLQRCGK SCRLRWINYL  120
RPDLKRGAFS PQEEELIIHL HSLLGNRWSQ IAARLPGRTD NEIKNFWNST IKKRLKNSSS  180
SSTPSPNNSD SSEHRDVMGG LMPMSEQDIM AWCMDSSSSS SPSMLAMAMS NQFQTLPPLD  240
NSYDMSATAG YFNNASQCFT QVGVGDSFYG DHGIFGGGDD MGVGVGGELF VPPLESIGLE  300
NSTVTDSDIH KKIPNYTNND HYFSNIDSII NHCNNSSSSS NKIEXLIGVG SYWEGQNLRM  360
GEWDLGDLMG DVSSYPFLDF QVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28671752108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278997.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0E4B8Y51e-127A0A0E4B8Y5_9R
STRINGPOPTR_0009s06630.11e-123(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-60myb domain protein 46